PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G0012
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 168aa    MW: 19365.8 Da    PI: 10.5035
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G0012genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-18956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l ++v+++G+g W++I++  g++R++k+c++rw +yl
      Gh_A11G0012  9 KGLWSAEEDSILMEYVRKHGKGKWNRIPKVTGLKRCGKSCRLRWINYL 56
                     678*******************************************97 PP

2Myb_DNA-binding52.89.2e-1762107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr++ +E +l+++++++lG++ W++ a +++ gRt++q+k++w+++l
      Gh_A11G0012  62 RGRFSDQENDLIIRLHNLLGNR-WSLMAGRVP-GRTDNQVKNHWNTHL 107
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.61160IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-23359IPR009057Homeodomain-like
SuperFamilySSF466892.68E-307103IPR009057Homeodomain-like
SMARTSM007173.6E-14858IPR001005SANT/Myb domain
PfamPF002492.4E-16956IPR001005SANT/Myb domain
CDDcd001672.10E-111256No hitNo description
Gene3DG3DSA:1.10.10.606.8E-2560111IPR009057Homeodomain-like
PROSITE profilePS5129420.16161111IPR017930Myb domain
SMARTSM007179.8E-1561109IPR001005SANT/Myb domain
PfamPF002496.8E-1562107IPR001005SANT/Myb domain
CDDcd001677.93E-1064107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MEEKSEYKKG LWSAEEDSIL MEYVRKHGKG KWNRIPKVTG LKRCGKSCRL RWINYLSPGV  60
KRGRFSDQEN DLIIRLHNLL GNRWSLMAGR VPGRTDNQVK NHWNTHLSKK LGIIKNPTAH  120
SSQSQTHSKS SRDDDNNHSQ AQDQVMMTTT DALPSPRDYG NGSSSWFW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-2791117108B-MYB
1h8a_C1e-26611124128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.38300.0boll
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO738523110.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2443491e-139GU244349.1 Gossypium arboreum MYB transcription factor (MYB) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488361.11e-120PREDICTED: transcription factor MYB114-like
SwissprotQ9SEI02e-64WER_ARATH; Transcription factor WER
TrEMBLD2KP371e-122D2KP37_G
STRINGVIT_17s0000g08480.t015e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-64myb domain protein 66